Alpha Diagnostic International, Inc. Datasheets for Biological Materials

Biological materials are biocompatible materials, natural or man-made, that comprise a whole or a part of a living structure or biomedical device that performs, augments, or replaces a natural function
Biological Materials: Learn more

Page: 1 3 4 5 6 7 8 9 10 11 12 13 14 15 20
Product Name Notes
Adult Human Tissues (11 ) ReadyBlot tissue Protein Explorer, 1 blot -- HTWB-10
Adult Human Tissues (11 ) ReadyBlot tissue Protein Explorer, 1 blot General Information SpeciesReactivity Human Form Immunoblot For research use only, not for diagnostic or therapeutic use.
Adult Human Tissues (customized tissues) ReadyBlot tissue Protein Explorer, 1 blot -- HTWB-C1
Adult Human Tissues (customized tissues) ReadyBlot tissue Protein Explorer, 1 blot General Information SpeciesReactivity Human Form Immunoblot For research use only, not for diagnostic or therapeutic use.
Albumin-X, Albumin (multiple species) removal kit (sufficient to remove 6-10 mg albumin or process ~200-300 ul serum; 10 mini-columns ~1.25 ml resin) -- LT-700MS-300ULX-10XC
Albumin-X, Albumin (multiple species) removal kit (sufficient to remove 6-10 mg albumin or process ~200-300 ul serum; 10 mini-columns ~1.25 ml resin) General Information Form Contains 10 ready to use...
Anti-B. Anthracis Lethal factor (LF) (C-terminal peptide) IgG#3 -- LF13-A
Anti-B. Anthracis Lethal factor (LF) (C-terminal peptide) IgG#3 General Information After inhalation by mammals, Bacillus anthracis spores germinate in alveolar macrophages then migrate to lymph nodes where they multiply. The...
Anti-B. Anthracis Lethal factor (LF) recombinant protein antiserum -- LF14-A
Anti-B. Anthracis Lethal factor (LF) recombinant protein antiserum General Information After inhalation by mammals, Bacillus anthracis spores germinate in alveolar macrophages then migrate to lymph nodes where they multiply. The...
Anti-bovine Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) antiserum -- IGFBP21-S
Anti-bovine Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) antiserum General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2, BP2, IBP2 Gene name Name: IGFBP2...
Anti-Human glutamate/GABA Inhibitory protein factor (IPF) antiserum -- IPF14-S
Anti-Human glutamate/GABA Inhibitory protein factor (IPF) antiserum General Information Glutamate is the main excitatory neurotransmitter in the brain. To date five glutamate Transporters have been cloned: GLAST (EAAT1), GLT1 (EAAT2),...
Anti-Human glutamate/GABA Inhibitory protein factor (IPF) IgG, aff pure -- IPF14-A
Anti-Human glutamate/GABA Inhibitory protein factor (IPF) IgG, aff pure General Information Glutamate is the main excitatory neurotransmitter in the brain. To date five glutamate Transporters have been cloned: GLAST (EAAT1),...
Anti-Human Human Ki67 (Proliferation Marker) peptide IgG -- KI671-A
Anti-Human Human Ki67 (Proliferation Marker) peptide IgG -- KI672-M
Anti-Human Human Ki67 (Proliferation Marker) peptide IgG General Information Estrogens, produced by ovaries and testis, affect growth and differentiation of many target tissues. Estrogens bind to the intracellular proteins known...
Anti-Human Ice Protease-Activating Factor (IPAF) or CARD12 antiserum -- IPAF11-S
Anti-Human Ice Protease-Activating Factor (IPAF) or CARD12 antiserum General Information Ice Protease-Activating Factor (IPAF) or CARD12 is a member of the Ced4 family and can induce apoptosis. Full length IPAF...
Anti-Human Ice Protease-Activating Factor (IPAF) or CARD12 IgG, aff pure -- IPAF11-A
Anti-Human Ice Protease-Activating Factor (IPAF) or CARD12 IgG, aff pure General Information Ice Protease-Activating Factor (IPAF) or CARD12 is a member of the Ced4 family and can induce apoptosis. Full...
Anti-Human Iceberg antiserum -- ICEBERG11-S
Anti-Human Iceberg antiserum General Information Apoptosis or programmed cell death is a fundamental cellular process that is essential for normal tissue development and abnormal growth such as cancer, neurodegeneration, autoimmune...
Anti-Human Iceberg IgG, aff. Pure -- ICEBERG11-A
Anti-Human Iceberg IgG, aff. Pure General Information Apoptosis or programmed cell death is a fundamental cellular process that is essential for normal tissue development and abnormal growth such as cancer,...
Anti-Human Insulin IgG, aff pure -- INSL17-A
Anti-Human Insulin IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will be...
Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein antiserum -- IGFBP11-S
Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein antiserum General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have...
Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) antiserum -- IGFBP31-S
Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) antiserum General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the...
Anti-Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein antiserum -- IGFBP41-S
Anti-Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein antiserum General Information Insulin-like growth factor binding protein-4 (IGFBP-4, 22-237 aa mature protein, protein accession # P22692) is expressed in multiple...
Anti-Human Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein antiserum -- IGFBP51-S
Anti-Human Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein antiserum General Information Human IGFBP-5 is a 252-aa mature protein that is expressed by fibroblasts, myoblasts and osteoblasts, making it the...
Anti-Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure -- IGFBP61-A
Anti-Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP...
Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein IgG, aff pure -- IGFBP71-A
Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein IgG, aff pure General Information IGF-BP7 is expressed in a wide range of normal human tissues and it generally shows reduced...
Anti-Human K-Cl Cotransporter 3 (KCC3) antiserum #1 -- KCC31-S
Anti-Human K-Cl Cotransporter 3 (KCC3) antiserum #1 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is involved...
Anti-Human K-Cl Cotransporter 3 (KCC3) IgG #1, aff pure -- KCC31-A
Anti-Human K-Cl Cotransporter 3 (KCC3) IgG #1, aff pure General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process...
Anti-Human K-Cl Cotransporter 4 (KCC4) antiserum #2 -- KCC42-S
Anti-Human K-Cl Cotransporter 4 (KCC4) antiserum #2 General Information Most recently, KCC4 (mouse and human 1083 aa) have been cloned that are 65-71% identical to KCC1/KCC2. It is highly expressed...
Anti-Human K-Cl Cotransporter 4 (KCC4) IgG #2, aff pure -- KCC42-A
Anti-Human K-Cl Cotransporter 4 (KCC4) IgG #2, aff pure General Information Most recently, KCC4 (mouse and human 1083 aa) have been cloned that are 65-71% identical to KCC1/KCC2. It is...
Anti-Human KST1 antiserum # 1 -- KST11-S
Anti-Human KST1 antiserum # 1 General Information The Human KST11-P peptide sequence is 66% conserved rabbit KST1. It has not yet been cloned from other species. No significant sequence homology...
Anti-Human KST1 IgG # 1, aff pure -- KST11-A
Anti-Human KST1 IgG # 1, aff pure General Information The Human KST11-P peptide sequence is 66% conserved rabbit KST1. It has not yet been cloned from other species. No significant...
Anti-Human Leuteinizing Hormone releasing hormone (LHRH) Antiserum #1 -- LHRH11-S
Anti-Human Leuteinizing Hormone releasing hormone (LHRH) Antiserum #1 General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested...
Anti-Human Leuteinizing Hormone releasing hormone (LHRH) IgG #1, aff pure -- LHRH11-A
Anti-Human Leuteinizing Hormone releasing hormone (LHRH) IgG #1, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have...
Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) Control/blocking peptide -- LEAP21-P
Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) Control/blocking peptide -- LEAP22-P
Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) Control/blocking peptide General Information From human blood ultrafiltrate, a novel gene-encoded, cysteine-rich, and cationic peptide termed as liver-expressed antimicrobial peptide 2 (LEAP-2) together with...
Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) IgG #1 (aff pure) -- LEAP21-A
Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) IgG #1 (aff pure) -- LEAP22-A
Anti-Human Liver-expressed antimicrobial peptide 2 (LEAP2) IgG #1 (aff pure) General Information From human blood ultrafiltrate, a novel gene-encoded, cysteine-rich, and cationic peptide termed as liver-expressed antimicrobial peptide 2 (LEAP-2)...
Anti-Human Livin antiserum -- LIVN11-S
Anti-Human Livin antiserum General Information Human Livin (1-280 aa. ~32 Kda) was expressed as his-tag protein in E. colli and purified >95%. For western blot +ve control (Cat # LIVN11-C),...
Anti-Human Livin IgG, aff. Pure -- LIVN11-A
Anti-Human Livin IgG, aff. Pure General Information Human Livin (1-280 aa. ~32 Kda) was expressed as his-tag protein in E. colli and purified >95%. For western blot +ve control (Cat...
Anti-Human musculo aponeurotic fibrosarcoma oncogene family (hMafF) antiserum -- MAFF11-S
Anti-Human musculo aponeurotic fibrosarcoma oncogene family (hMafF) antiserum General Information The US-2 element in the promoter of the human oxytocin receptor gene (OTR) binds specifically nuclear proteins from human myometrium...
Anti-Human musculo aponeurotic fibrosarcoma oncogene family (hMafF) IgG, aff pure -- MAFF11-A
Anti-Human musculo aponeurotic fibrosarcoma oncogene family (hMafF) IgG, aff pure General Information The US-2 element in the promoter of the human oxytocin receptor gene (OTR) binds specifically nuclear proteins from...
Anti-Human novel liver specific OAT (LST-1) antiserum #1 -- LST11-S
Anti-Human novel liver specific OAT (LST-1) antiserum #1 General Information Most recently, a novel liver-specific OAT, LST-1, has been cloned from human liver. It has also been detected in mouse...
Anti-Human novel liver specific OAT (LST-1) IgG #1, aff pure -- LST11-A
Anti-Human novel liver specific OAT (LST-1) IgG #1, aff pure General Information Most recently, a novel liver-specific OAT, LST-1, has been cloned from human liver. It has also been detected...
Anti-Human Plasma Kallikrein IgG -- KAL11-A
Anti-Human Plasma Kallikrein IgG General Information SugApplications ELISA, Western IHC/IF SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Human SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form Antibody pure IgG Antigen Purified protein...
Anti-Human Recomb. Leptin Protein antiserum # 2 -- LEP12-S
Anti-Human Recomb. Leptin Protein antiserum # 2 General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five...
Anti-Human Recombinant Purified Leptin binding domain antiserum -- LEPBP11-S
Anti-Human Recombinant Purified Leptin binding domain antiserum General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and...
Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) antiserum #2 -- KCC32-S
Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) antiserum #2 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is involved...
Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) IgG #2, aff pure -- KCC32-A
Anti-Human/Mouse K-Cl Cotransporter 3 (KCC3) IgG #2, aff pure General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process...
Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure -- INSA21-A
Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure General Information SugSecAntibodies http://4adi.com/comm erce/ccc2482-seconda ry-antibodies-g--pig .htm SpeciesReactivity Human SugNegativeControl Non-immune G. Pig IgG Cat# 20004-1 Form Affinity purified IgG For research...
Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure -- INSB22-A
Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure General Information SugSecAntibodies http://4adi.com/comm erce/ccc2482-seconda ry-antibodies-g--pig .htm SpeciesReactivity Human SugNegativeControl Non-immune G. Pig IgG Cat# 20004-1 Form Affinity purified IgG For research...
Anti-KLH (keyhole limpet hemocyanin) antiserum #3 -- KLH13-S
Anti-KLH (keyhole limpet hemocyanin) antiserum #3 General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Anti-KLH (keyhole limpet hemocyanin) antiserum #4 -- KLH14-S
Anti-KLH (keyhole limpet hemocyanin) antiserum #4 General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Anti-KLH (keyhole limpet hemocyanin) antiserum #5 -- KLH15-S
Anti-KLH (keyhole limpet hemocyanin) antiserum #5 General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Anti-lethal factor (B Anthracis) IgG-biotinylated -- LF16-AB
Anti-lethal factor (B Anthracis) IgG-biotinylated General Information Anthrax lethal toxin produced by the bacterium Bacillus anthracis is the major cause of death in animals infected with anthrax. One component of...
Anti-lethal factor (B Anthracis) IgG -- LF16-A
Anti-lethal factor (B Anthracis) IgG General Information Anthrax lethal toxin produced by the bacterium Bacillus anthracis is the major cause of death in animals infected with anthrax. One component of...
Anti-Luciferase (Fire fly) IgG-Biotin Conjugate -- LUCF11-BTN
Anti-Luciferase (Fire fly) IgG-Biotin Conjugate General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that may...
Anti-Luciferase (Fire fly) IgG-HRP Conjugate -- LUCF11-HRP
Anti-Luciferase (Fire fly) IgG-HRP Conjugate General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that may...
Anti-Luciferase (Fire fly) IgG -- LUCF11-A
Anti-Luciferase (Fire fly) IgG General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that may otherwise...
Anti-Luciferase (Photobacterium fischerii) IgG-Biotin Conjugate -- LUCF12-BTN
Anti-Luciferase (Photobacterium fischerii) IgG-Biotin Conjugate General Information SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Photobacterium fischerii SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form Biotin Conjugate For research use only, not for...
Anti-Luciferase (Photobacterium fischerii) IgG-FITC Conjugate -- LUCF12-FITC
Anti-Luciferase (Photobacterium fischerii) IgG-FITC Conjugate General Information SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Photobacterium fischerii SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form FITC conjugate For research use only, not for...
Anti-Luciferase (Photobacterium fischerii) IgG-HRP Conjugate -- LUCF12-HRP
Anti-Luciferase (Photobacterium fischerii) IgG-HRP Conjugate General Information SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Photobacterium fischerii SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form HRP conjugate For research use only, not for...
Anti-Luciferase (Photobacterium fischerii) IgG -- LUCF12-A
Anti-Luciferase (Photobacterium fischerii) IgG General Information SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Photobacterium fischerii SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form Affinity purified IgG SugPositiveControl Recombinant or naturally purified proteins...
Anti-Maltose binding protein (MBP) (fusion tag) IgG -- MBP12-A
Anti-Maltose binding protein (MBP) (fusion tag) IgG General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins...
Anti-Mosue NOS-II/i-NOS Antiserum # 1 -- iNOS-S
Anti-Mosue NOS-II/i-NOS Antiserum # 1 General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized by L-arginine,...
Anti-Mouse beta-Defensin 1 antiserum #1 -- MBD11-S
Anti-Mouse beta-Defensin 1 antiserum #1 General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into two families...
Anti-Mouse beta-Defensin 1, IgG #1, aff pure -- MBD11-A
Anti-Mouse beta-Defensin 1, IgG #1, aff pure General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into...
Anti-Mouse beta-Defensin 4 antiserum #1 -- MBD41-S
Anti-Mouse beta-Defensin 4 antiserum #1 General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into two families...
Anti-Mouse beta-Defensin 4, IgG #1, aff pure -- MBD41-A
Anti-Mouse beta-Defensin 4, IgG #1, aff pure General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into...
Anti-Mouse Hexokinase 1 (HXK-I) IgG, aff pure -- HXK13-A
Anti-Mouse Hexokinase 1 (HXK-I) IgG, aff pure General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by...
Anti-Mouse Hexokinase 2 (HXK-II) IgG, aff pure -- HXK23-A
Anti-Mouse Hexokinase 2 (HXK-II) IgG, aff pure General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by...
Anti-Mouse Hexokinase 3 (HXK-III) IgG, aff pure -- HXK33-A
Anti-Mouse Hexokinase 3 (HXK-III) IgG, aff pure General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by...
Anti-Mouse Hexokinase 4/GCK (HXK-IV), IgG, aff pure -- HXK43A
Anti-Mouse Hexokinase 4/GCK (HXK-IV), IgG, aff pure General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by...
Anti-Mouse Hexokinases 1-4 (HXK1-IV), IgG, aff pure -- HXKX15-A
Anti-Mouse Hexokinases 1-4 (HXK1-IV), IgG, aff pure General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by...
Anti-Mouse IRS-2, aff pure IgG -- IRS21-A
Anti-Mouse IRS-2, aff pure IgG General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will be...
Anti-Mouse K-Cl Cotransporter 4 (KCC4) antiserum #1 -- KCC41-S
Anti-Mouse K-Cl Cotransporter 4 (KCC4) antiserum #1 General Information Most recently, KCC4 (mouse and human 1083 aa) have been cloned that are 65-71% identical to KCC1/KCC2. It is highly expressed...
Anti-Mouse K-Cl Cotransporter 4 (KCC4) IgG #1, aff pure -- KCC41-A
Anti-Mouse K-Cl Cotransporter 4 (KCC4) IgG #1, aff pure General Information Most recently, KCC4 (mouse and human 1083 aa) have been cloned that are 65-71% identical to KCC1/KCC2. It is...
Anti-Mouse Klotho Antiserum -- KL11-S
Anti-Mouse Klotho Antiserum General Information Animal models of human aging, which display the characteristic diseases associated with aging, provide insight into the cause of such diseases. Recently a transgenic mouse...
Anti-Mouse Klotho IgG, aff pure -- KL11-A
Anti-Mouse Klotho IgG, aff pure General Information Animal models of human aging, which display the characteristic diseases associated with aging, provide insight into the cause of such diseases. Recently a...
Anti-Mouse Lipin-1 IgG #1, Aff. Pure -- LPN11-A
Anti-Mouse Lipin-1 IgG #1, Aff. Pure General Information Lipin-1: The human and mouse LPIN-1 genes have been mapped at chromosomes 2p21 and 12, respectively. A region (POMC) on this same...
Anti-Mouse Lipin-2 IgG #1, Aff. Pure -- LPN21-A
Anti-Mouse Lipin-2 IgG #1, Aff. Pure General Information Lipin-2: The human and mouse LPIN-2 genes have been mapped at chromosomes 18p and 17, respectively. The Lipin-2 seqs from mouse and...
Anti-Mouse Lipin-3 IgG #1, Aff. Pure -- LPN31-A
Anti-Mouse Lipin-3 IgG #1, Aff. Pure General Information Lipin-3: The human (LPIN3) and mouse Lipin3 genes have been mapped at chromosomes 20q and 2, respectively. The overall aa seq of...
Anti-Mouse NOS-II/i-NOS IgG # 2 -- INOS22-S
Anti-Mouse NOS-II/i-NOS IgG # 2 General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized by L-arginine,...
Anti-Mouse NOS-II/iNOS IgG # 1, aff pure -- iNOS-A
Anti-Mouse NOS-II/iNOS IgG # 1, aff pure General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized...
Anti-Mouse Recomb. Leptin Protein antiserum # 1 -- LEP11-S
Anti-Mouse Recomb. Leptin Protein antiserum # 1 General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five...
Anti-Mouse Recomb. Leptin Protein IgG # 1, aff pure -- LEP11-A
Anti-Mouse Recomb. Leptin Protein IgG # 1, aff pure General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At...
Anti-Mouse/human beta-Defensin 3 antiserum #1 -- MBD31-S
Anti-Mouse/human beta-Defensin 3 antiserum #1 General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into two families...
Anti-Mouse/human beta-Defensin 3, IgG #1, aff pure -- MBD31-A
Anti-Mouse/human beta-Defensin 3, IgG #1, aff pure General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into...
Anti-Mouse/Human Mahogany antiserum #1 -- MAHG11-S
Anti-Mouse/Human Mahogany antiserum #1 General Information The Mahogany (mg) mutations suppress the effect of lethal yellow including obesity. The Mahogany locus does not suppress the obese phenotype of the MC4R...
Anti-mouse/Human Mahogany IgG #1, aff pure -- MAHG11-A
Anti-mouse/Human Mahogany IgG #1, aff pure General Information The Mahogany (mg) mutations suppress the effect of lethal yellow including obesity. The Mahogany locus does not suppress the obese phenotype of...
Anti-Porcine Insulin antiserum -- INSL12-S
Anti-Porcine Insulin antiserum General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will be listed in...
Anti-Rat IRAP (Insulin regulated aminopeptidase) Antiserum #1 -- IRAP11-S
Anti-Rat IRAP (Insulin regulated aminopeptidase) Antiserum #1 General Information SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Rat SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form Antiserum Unpurified SugPositiveControl Recombinant or naturally purified...
Anti-Rat IRAP (Insulin regulated aminopeptidase) IgG #1, aff pure -- IRAP11-A
Anti-Rat IRAP (Insulin regulated aminopeptidase) IgG #1, aff pure General Information SugSecAntibodies http://4adi.com/comm erce/ccc2480-seconda ry-antibodies-rabbit .htm SpeciesReactivity Rat SugNegativeControl Non-immune Rabbit IgG Cat# 20009-1 Form Affinity purified IgG SugPositiveControl Recombinant...
Anti-Rat Iron regulatory protein 1 (IRP-1) antiserum -- IRP11-S
Anti-Rat Iron regulatory protein 1 (IRP-1) antiserum General Information Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation of ferritin,...
Anti-Rat Iron regulatory protein 1 (IRP-1) IgG, aff pure -- IRP11-A
Anti-Rat Iron regulatory protein 1 (IRP-1) IgG, aff pure General Information Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation...
Anti-Rat K-Cl Cotransporter 1 (KCC1) ab #1, aff pure -- KCC11-A
Anti-Rat K-Cl Cotransporter 1 (KCC1) ab #1, aff pure General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process...
Anti-Rat K-Cl Cotransporter 1 (KCC1) antiserum #1 -- KCC11-S
Anti-Rat K-Cl Cotransporter 1 (KCC1) antiserum #1 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is involved...
Anti-Rat K-Cl Cotransporter 2 (KCC2) antiserum #1 -- KCC21-S
Anti-Rat K-Cl Cotransporter 2 (KCC2) antiserum #1 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is involved...
Anti-Rat K-Cl Cotransporter 2 (KCC2) IgG #1, aff pure -- KCC21-A
Anti-Rat K-Cl Cotransporter 2 (KCC2) IgG #1, aff pure General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process...
Anti-Rat/human Iron regulatory protein 2 (IRP-2) antiserum -- IRP21-S
Anti-Rat/human Iron regulatory protein 2 (IRP-2) antiserum General Information Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation of ferritin,...
Anti-Rat/human Iron regulatory protein 2 (IRP-2) IgG, aff pure -- IRP21-A
Anti-Rat/human Iron regulatory protein 2 (IRP-2) IgG, aff pure General Information Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation...
Bovine Insulin-agarose affinity support -- INSL15-AS
Bovine Insulin-agarose affinity support General Information SpeciesReactivity Bovine Form Affinity column For research use only, not for diagnostic or therapeutic use.
Bovine pancrease Insulin (~30 USP U/mg) -- INSL15-N-10
Bovine pancrease Insulin (~30 USP U/mg) General Information SpeciesReactivity Bovine Form Antigen protein Antigen Bovine insulin For research use only, not for diagnostic or therapeutic use.
Bovine Recombinant Purified Leptin Protein -- LEP15-R-50
Bovine Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Chicken Recombinant Purified Leptin binding domain -- LEPBP16-R-50
Chicken Recombinant Purified Leptin binding domain General Information SpeciesReactivity Chicken Form Antigen Protein Antigen Recombinant chciken leptin binding domaim (LBD, 208-aa) was cloned, expressed in E. Coli and purified (>95%...
Chicken Recombinant Purified Leptin Protein -- LEP18-R-50
Chicken Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Custom Production of Monoclonal antibodies (immunization, ELISA, fusion, screening, Cloning of up to 3 clones) -- MAB-1
Custom Production of Monoclonal antibodies (immunization, ELISA, fusion, screening, Cloning of up to 3 clones) General Information SpeciesReactivity Mouse For research use only, not for diagnostic or therapeutic use.
Custom purification of IgY from up to 12 egg yolks -- IGY-2
Custom purification of IgY from up to 12 egg yolks General Information For research use only, not for diagnostic or therapeutic use.
Custom purification of IgY from up to 6 egg yolks -- IGY-1
Custom purification of IgY from up to 6 egg yolks General Information For research use only, not for diagnostic or therapeutic use.
Customized Human Tumor Tissue Blot -- HTPB-1541
Customized Human Tumor Tissue Blot General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use only, not for diagnostic or therapeutic use.
DABCYL-ERNleFLSFP-EDANS, Malaria Aspartyl Proteinase FRET (Fluorescence Resonance Energy Transfer) Substrate I -- MAPF15-P
DABCYL-ERNleFLSFP-ED ANS, Malaria Aspartyl Proteinase FRET (Fluorescence Resonance Energy Transfer) Substrate I General Information SpeciesReactivity malaria Form Pure peptide For research use only, not for diagnostic or therapeutic use.
DELFNELLNSVDVNGENILEESQ, P. falciparum Liver-Stage Antigen 3-NRI (LSA3-NRI) peptide -- LSPF32-P
DELFNELLNSVDVNGENILE ESQ, P. falciparum Liver-Stage Antigen 3-NRI (LSA3-NRI) peptide General Information SpeciesReactivity P. falciparum Form Pure peptide For research use only, not for diagnostic or therapeutic use.
Dog Recombinant Purified Leptin Protein -- LEP19-R-50
Dog Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Horse Recombinant Purified Leptin Protein -- LEP17-R-50
Horse Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Human (Normal/Adult) Universal (pool of tissue cDNA) -- HUUC-568
Human (Normal/Adult) Universal (pool of tissue cDNA) General Information SpeciesReactivity Human Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Adult Tissues Protein lysate, Universal -- HUUL-4565
Human Adult Tissues Protein lysate, Universal General Information Form Cell/Tissue Protein Lysate For research use only, not for diagnostic or therapeutic use.
Human Bladder Slide (Malignant epithelial tumor) (5 slides/pk) -- HTS-12610
Human Bladder Slide (Malignant epithelial tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Bladder Slide (Normal) (5 slides/pk) -- HTS-12601
Human Bladder Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Bladder Slide (Papillary Carcinoma) (5 slides/pk) -- HTS-12612
Human Bladder Slide (Papillary Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Bladder Tumor lysate -- HTL-1325
Human Bladder Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Bone Slide (Chondrosarcoma) (5 slides/pk) -- HTS-12907
Human Bone Slide (Chondrosarcoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Brain Slide (Normal) (5 slides/pk) -- HTS-10301
Human Brain Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Brain Slide (Tumor) (5 slides/pk) -- HTS-10302
Human Brain Slide (Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Brain Tumor lysate -- HTL-1322
Human Brain Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Breast Slide (Abnormal) (5 slides/pk) -- HTS-10020
Human Breast Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Breast Slide (Benign) (5 slides/pk) -- HTS-10003
Human Breast Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Breast Slide (Carcinoma) (5 slides/pk) -- HTS-10009
Human Breast Slide (Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Breast Slide (Ductal Carcinoma In Situ (DCIS)) (5 slides/pk) -- HTS-10010
Human Breast Slide (Ductal Carcinoma In Situ (DCIS)) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research...
Human Breast Slide (Fibroadenoma) (5 slides/pk) -- HTS-10004
Human Breast Slide (Fibroadenoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Breast Slide (Normal) (5 slides/pk) -- HTS-10001
Human Breast Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Breast Slide (Poorly differentiated carcinoma) (5 slides/pk) -- HTS-10013
Human Breast Slide (Poorly differentiated carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Breast Slide (Well differentiated Carcinoma) (5 slides/pk) -- HTS-10012
Human Breast Slide (Well differentiated Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Breast Tumor lysate -- HTL-1323
Human Breast Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Cartilage Slide (Benign) (5 slides/pk) -- HTS-12903
Human Cartilage Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Cervix Slide (Abnormal) (5 slides/pk) -- HTS-11316
Human Cervix Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Cervix Slide (Benign) (5 slides/pk) -- HTS-11303
Human Cervix Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Cervix Slide (Condyloma acuminatum) (5 slides/pk) -- HTS-11304
Human Cervix Slide (Condyloma acuminatum) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Cervix Slide (Interepithelial Neoplasia (squamous dysplasia)) (5 slides/pk) -- HTS-11305
Human Cervix Slide (Interepithelial Neoplasia (squamous dysplasia)) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Cervix Slide (Normal) (5 slides/pk) -- HTS-11301
Human Cervix Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Cervix Slide (Squamous Cell Carcinoma) (5 slides/pk) -- HTS-11307
Human Cervix Slide (Squamous Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Cervix Tumor lysate -- HTL-1326
Human Cervix Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Colon Tumor lystae -- HTL-1327
Human Colon Tumor lystae General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Colorectal Colon Slide (Abnormal) (5 slides/pk) -- HTS-10719
Human Colorectal Colon Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Colorectal Colon Slide (Mucinous Carcinoma) (5 slides/pk) -- HTS-10705
Human Colorectal Colon Slide (Mucinous Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Colorectal Colon Slide (Unclassified Carcinoma) (5 slides/pk) -- HTS-10710
Human Colorectal Colon Slide (Unclassified Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Colorectal Slide (Adenocarcinoma) (5 slides/pk) -- HTS-10704
Human Colorectal Slide (Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Colorectal Slide (Benign) (5 slides/pk) -- HTS-10702
Human Colorectal Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Colorectal Slide (Normal) (5 slides/pk) -- HTS-10701
Human Colorectal Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Duodenum Tumor lysate -- HTL-1328
Human Duodenum Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Esophagus tumor lysate -- HTL-1329
Human Esophagus tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Esophogus Slide (Squamous Cell Carcinoma) (5 slides/pk) -- HTS-12505
Human Esophogus Slide (Squamous Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Gall Bladder Slide (Abnormal) (5 slides/pk) -- HTS-12417
Human Gall Bladder Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Gall Bladder Slide (Benign) (5 slides/pk) -- HTS-12403
Human Gall Bladder Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Gall Bladder Slide (Normal) (5 slides/pk) -- HTS-12401
Human Gall Bladder Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human glutamate/GABA Inhibitory protein factor (IPF) control/blocking peptide -- IPF14-P
Human glutamate/GABA Inhibitory protein factor (IPF) control/blocking peptide General Information Glutamate is the main excitatory neurotransmitter in the brain. To date five glutamate Transporters have been cloned: GLAST (EAAT1), GLT1...
Human Heart Slide (Abnormal) (5 slides/pk) -- HTS-10525
Human Heart Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Heart Slide (Myxoma) (5 slides/pk) -- HTS-10503
Human Heart Slide (Myxoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Heart Slide (Normal) (5 slides/pk) -- HTS-10501
Human Heart Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Heart Slide (Tumor) (5 slides/pk) -- HTS-10502
Human Heart Slide (Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human ice Protease-Activating Factor (IPAF) or CARD12 Control/blocking peptide -- IPAF11-P
Human ice Protease-Activating Factor (IPAF) or CARD12 Control/blocking peptide General Information Ice Protease-Activating Factor (IPAF) or CARD12 is a member of the Ced4 family and can induce apoptosis. Full length...
Human Iceberg control (blocking) peptide -- ICEBERG11-P
Human Iceberg control (blocking) peptide General Information Apoptosis or programmed cell death is a fundamental cellular process that is essential for normal tissue development and abnormal growth such as cancer,...
Human IL-2 ELISPOT Set/Kit -- IL2-E-10
Human IL-2 ELISPOT Set/Kit General Information Form Kit For research use only, not for diagnostic or therapeutic use.
Human K-Cl Cotransporter 3 (KCC3) Control/blocking peptide #1 -- KCC31-P
Human K-Cl Cotransporter 3 (KCC3) Control/blocking peptide #1 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is...
Human K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #2 -- KCC42-P
Human K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #2 General Information Most recently, KCC4 (mouse and human 1083 aa) have been cloned that are 65-71% identical to KCC1/KCC2. It is highly...
Human Kidney Slide (Abnormal) (5 slides/pk) -- HTS-10455
Human Kidney Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Kidney Slide (Clear Cell Renal Cell Carcinoma) (5 slides/pk) -- HTS-10405
Human Kidney Slide (Clear Cell Renal Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research...
Human Kidney Slide (Normal) (5 slides/pk) -- HTS-10401
Human Kidney Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Kidney Slide (Papillary Renal Cell Carcinoma) (5 slides/pk) -- HTS-10407
Human Kidney Slide (Papillary Renal Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Kidney Slide (Renal Cell Carcinoma) (5 slides/pk) -- HTS-10414
Human Kidney Slide (Renal Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Kidney Slide (Renal Cell Neoplasia) (5 slides/pk) -- HTS-10403
Human Kidney Slide (Renal Cell Neoplasia) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Kidney Slide (Tumor) (5 slides/pk) -- HTS-10402
Human Kidney Slide (Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Kidney Tumor lysate -- HTL-1324
Human Kidney Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human KST1 Control/blocking peptide # 1 -- KST11-P
Human KST1 Control/blocking peptide # 1 General Information The Human KST11-P peptide sequence is 66% conserved rabbit KST1. It has not yet been cloned from other species. No significant sequence...
Human Leptin protein Western blot +ve control # 2 -- LEP12-C
Human Leptin protein Western blot +ve control # 2 General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At...
Human Leukemias/Lymphomas Tissue Slide (Leukemia Spleen) (5 slides/pk) -- HTS-11601
Human Leukemias/Lymphomas Tissue Slide (Leukemia Spleen) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Leukemias/Lymphomas Tissue Slide (Lymphoma) (5 slides/pk) -- HTS-11603
Human Leukemias/Lymphomas Tissue Slide (Lymphoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Leukemias/Lymphomas Tissue Slide (Mixed Leukemia and Lymphoma) (5 slides/pk) -- HTS-11606
Human Leukemias/Lymphomas Tissue Slide (Mixed Leukemia and Lymphoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research...
Human Leuteinizing Hormone releasing hormone (LHRH) Control/blocking peptide #1 -- LHRH11-P
Human Leuteinizing Hormone releasing hormone (LHRH) Control/blocking peptide #1 General Information SugApplications Control or blocking peptides are recommended for ELISA plate coating for direct ELISA testing of antibodies or competitive...
Human Liver Slide (Abnormal) (5 slides/pk) -- HTS-10237
Human Liver Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Liver Slide (Hepatocellular Carcinoma) (5 slides/pk) -- HTS-10222
Human Liver Slide (Hepatocellular Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Liver Slide (Malignant Tumor) (5 slides/pk) -- HTS-10220
Human Liver Slide (Malignant Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Liver Slide (Necrotic tissue) (5 slides/pk) -- HTS-10246
Human Liver Slide (Necrotic tissue) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Liver Slide (Normal) (5 slides/pk) -- HTS-10201
Human Liver Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Liver Tumor lysate -- HTL-1330
Human Liver Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Livin Control/blocking peptide -- LIVN11-P
Human Livin Control/blocking peptide General Information Human Livin (1-280 aa. ~32 Kda) was expressed as his-tag protein in E. colli and purified >95%. For western blot +ve control (Cat #...
Human Lung Slide (Abnormal) (5 slides/pk) -- HTS-10110
Human Lung Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Lung Slide (Adenocarcinoma) (5 slides/pk) -- HTS-10106
Human Lung Slide (Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Lung Slide (Non-small cell carcinoma) (5 slides/pk) -- HTS-10104
Human Lung Slide (Non-small cell carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Lung Slide (Normal) (5 slides/pk) -- HTS-10101
Human Lung Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Lung Slide (Small cell carcinoma) (5 slides/pk) -- HTS-10103
Human Lung Slide (Small cell carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Lung Slide (Squamous cell carcinoma) (5 slides/pk) -- HTS-10105
Human Lung Slide (Squamous cell carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Lung Slide (Tumor) (5 slides/pk) -- HTS-10102
Human Lung Slide (Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human Lung Tumor Blot I - All Malignant (small, non-small cell differentiated adenocarcinoma, squamous pleomorphic) -- HTPB-1510
Human Lung Tumor Blot I - All Malignant (small, non-small cell differentiated adenocarcinoma, squamous pleomorphic) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use only, not for diagnostic...
Human Lung Tumor Blot II - Matching Pair #1 (A549, small, non-small, squamous cell carcinoma, matched normal lung tissue) -- HTPB-1511
Human Lung Tumor Blot II - Matching Pair #1 (A549, small, non-small, squamous cell carcinoma, matched normal lung tissue) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use...
Human Lung Tumor Blot II - Matching Pair #3 (A549, small cell, differentianted carcinoma, pleomorphic, matched normal lung tissue) -- HTPB-1513
Human Lung Tumor Blot II - Matching Pair #3 (A549, small cell, differentianted carcinoma, pleomorphic, matched normal lung tissue) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use...
Human Lung Tumor Blot II - Matching Pair #4 (A549, small cell, differentianted carcinoma, pleomorphic, matched normal lung tissue) -- HTPB-1514
Human Lung Tumor Blot II - Matching Pair #4 (A549, small cell, differentianted carcinoma, pleomorphic, matched normal lung tissue) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use...
Human Lung Tumor lysate -- HTL-1321
Human Lung Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Lymphoid Tissue Slide (Abnormal) (5 slides/pk) -- HTS-11504
Human Lymphoid Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Lymphoid Tissue Slide (Appendix Abnormal) (5 slides/pk) -- HTS-11515
Human Lymphoid Tissue Slide (Appendix Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Lymphoid Tissue Slide (Lymph node abnormal) (5 slides/pk) -- HTS-11525
Human Lymphoid Tissue Slide (Lymph node abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Lymphoid Tissue Slide (Lymph node benign) (5 slides/pk) -- HTS-11523
Human Lymphoid Tissue Slide (Lymph node benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Lymphoid Tissue Slide (Lymph node malignant) (5 slides/pk) -- HTS-11524
Human Lymphoid Tissue Slide (Lymph node malignant) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Lymphoid Tissue Slide (Lymph node normal) (5 slides/pk) -- HTS-11521
Human Lymphoid Tissue Slide (Lymph node normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Lymphoid Tissue Slide (Tonsil benign) (5 slides/pk) -- HTS-11533
Human Lymphoid Tissue Slide (Tonsil benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Lymphoma Tumor lysate -- HTL-1331
Human Lymphoma Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Melanoma Tissue Slide (5 slides/pk) -- HTS-12801
Human Melanoma Tissue Slide (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not for...
Human musculo aponeurotic fibrosarcoma oncogene family (hMafF) Control/blocking peptide -- MAFF11-P
Human musculo aponeurotic fibrosarcoma oncogene family (hMafF) Control/blocking peptide General Information The US-2 element in the promoter of the human oxytocin receptor gene (OTR) binds specifically nuclear proteins from human...
Human novel liver specific OAT (LST-1) Control/blocking peptide #1 -- LST11-P
Human novel liver specific OAT (LST-1) Control/blocking peptide #1 General Information Most recently, a novel liver-specific OAT, LST-1, has been cloned from human liver. It has also been detected in...
Human Ovary Tissue Slide (Abnormal) (5 slides/pk) -- HTS-11210
Human Ovary Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Ovary Tissue Slide (Benign Epithelial Tumor) (5 slides/pk) -- HTS-11203
Human Ovary Tissue Slide (Benign Epithelial Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Ovary Tissue Slide (Benign Sex Chord Stromal tumor) (5 slides/pk) -- HTS-11204
Human Ovary Tissue Slide (Benign Sex Chord Stromal tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For...
Human Ovary Tissue Slide (Benign) (5 slides/pk) -- HTS-11202
Human Ovary Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Ovary Tissue Slide (Epithelial tumor) (5 slides/pk) -- HTS-11207
Human Ovary Tissue Slide (Epithelial tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Ovary Tissue Slide (Malignant tumor) (5 slides/pk) -- HTS-11206
Human Ovary Tissue Slide (Malignant tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Ovary Tissue Slide (Normal) (5 slides/pk) -- HTS-11201
Human Ovary Tissue Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Ovary Tumor lysate -- HTL-1333
Human Ovary Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Pancreas Tissue Slide (Abnormal) (5 slides/pk) -- HTS-11106
Human Pancreas Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Pancreas Tissue Slide (Adenocarcinoma) (5 slides/pk) -- HTS-11105
Human Pancreas Tissue Slide (Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Pancreas Tissue Slide (normal) (5 slides/pk) -- HTS-11101
Human Pancreas Tissue Slide (normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Pancreas Tumor lysate -- HTL-1334
Human Pancreas Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Penis Tissue Slide (Malignant) (5 slides/pk) -- HTS-12204
Human Penis Tissue Slide (Malignant) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Prostate Tissue Slide (Hyperplasia) (5 slides/pk) -- HTS-10635
Human Prostate Tissue Slide (Hyperplasia) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Prostate Tumor lysate -- HTL-1335
Human Prostate Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Recombinant Purified Leptin binding domain -- LEPBP15-R-50
Human Recombinant Purified Leptin binding domain General Information SpeciesReactivity Human Form Antigen Protein Antigen Recombinant human leptin binding domaim (LBD, 208-aa) was cloned, expressed in E. Coli and purified (>95%...
Human Recombinant Purified Leptin Protein -- LEP12-R-10000
Human Recombinant Purified Leptin Protein General Information SpeciesReactivity Human Form Antigen Protein For research use only, not for diagnostic or therapeutic use.
Human Recombinant Purified Leptin Protein -- LEP12-R1000
Human Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Human Recombinant Purified Leptin Quadruple mutant Antagonist Protein -- LEP22-QM-100
Human Recombinant Purified Leptin Quadruple mutant Antagonist Protein General Information SpeciesReactivity Human Form Antigen Protein Antigen Leptin is ~16 kDa, adipocyte derived, secreted protein (1). Recombinant human leptin, containing 146...
Human Recombinant Purified Leptin Triple mutant Antagonist Protein -- LEP21-TM-20
Human Recombinant Purified Leptin Triple mutant Antagonist Protein General Information SpeciesReactivity Human Form Antigen Protein Antigen Leptin is ~16 kDa, adipocyte derived, secreted protein (1). Recombinant human leptin, containing 146...
Human Rectum Tumor lysate -- HTL-1336
Human Rectum Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Salivary Gland Tissue Slide (Abnormal) (5 slides/pk) -- HTS-12128
Human Salivary Gland Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Salivary Gland Tissue Slide (Mucoepidermoid carcinoma) (5 slides/pk) -- HTS-12109
Human Salivary Gland Tissue Slide (Mucoepidermoid carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Skin Tissue Slide (Abnormal) (5 slides/pk) -- HTS-12706
Human Skin Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Skin Tissue Slide (Basal Cell Carcinoma) (5 slides/pk) -- HTS-12705
Human Skin Tissue Slide (Basal Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Skin Tissue Slide (Benign) (5 slides/pk) -- HTS-12702
Human Skin Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Skin Tissue Slide (Normal) (5 slides/pk) -- HTS-12701
Human Skin Tissue Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Skin Tissue Slide (Squamous Cell Carcinoma) (5 slides/pk) -- HTS-12704
Human Skin Tissue Slide (Squamous Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Skin Tumor lysate -- HTL-1337
Human Skin Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Small Intestine Tissue Slide (Squamous Cell Carcinoma) (5 slides/pk) -- HTS-11801
Human Small Intestine Tissue Slide (Squamous Cell Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research...
Human Small Intestine Tumor lysate -- HTL-1338
Human Small Intestine Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Soft Tissue Slide (Abnormal) (5 slides/pk) -- HTS-12305
Human Soft Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Soft Tissue Slide (Adipose Abnormal) (5 slides/pk) -- HTS-12317
Human Soft Tissue Slide (Adipose Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Soft Tissue Slide (Adipose Benign) (5 slides/pk) -- HTS-12313
Human Soft Tissue Slide (Adipose Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Soft Tissue Slide (Adipose Lipoma) (5 slides/pk) -- HTS-12314
Human Soft Tissue Slide (Adipose Lipoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Soft Tissue Slide (Adipose Liposarcoma) (5 slides/pk) -- HTS-12316
Human Soft Tissue Slide (Adipose Liposarcoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Soft Tissue Slide (Adipose Normal) (5 slides/pk) -- HTS-12311
Human Soft Tissue Slide (Adipose Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Soft Tissue Slide (Adipose Undiagnosed) (5 slides/pk) -- HTS-12310
Human Soft Tissue Slide (Adipose Undiagnosed) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Soft Tissue Slide (Benign) (5 slides/pk) -- HTS-12303
Human Soft Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Soft Tissue Slide (Skeletal Muscle Benign) (5 slides/pk) -- HTS-12343
Human Soft Tissue Slide (Skeletal Muscle Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Soft Tissue Slide (Skeletal Muscle Malignant) (5 slides/pk) -- HTS-12345
Human Soft Tissue Slide (Skeletal Muscle Malignant) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Soft Tissue Slide (Skeletal Muscle Normal) (5 slides/pk) -- HTS-12341
Human Soft Tissue Slide (Skeletal Muscle Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Spinal Cord Tissue Slide (normal) (5 slides/pk) -- HTS-13101
Human Spinal Cord Tissue Slide (normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Spleen Tissue Slide (Benign) (5 slides/pk) -- HTS-10903
Human Spleen Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Spleen Tissue Slide (Normal) (5 slides/pk) -- HTS-10901
Human Spleen Tissue Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Spleen Tissue Slide (Unknown) (5 slides/pk) -- HTS-10900
Human Spleen Tissue Slide (Unknown) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Spleen Tumor lysate -- HTL-1339
Human Spleen Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Stomach Tissue Slide (Abnormal) (5 slides/pk) -- HTS-10826
Human Stomach Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Stomach Tissue Slide (Adenocarcinoma) (5 slides/pk) -- HTS-10809
Human Stomach Tissue Slide (Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Stomach Tissue Slide (Benign) (5 slides/pk) -- HTS-10803
Human Stomach Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Stomach Tissue Slide (Carcinoma) (5 slides/pk) -- HTS-10807
Human Stomach Tissue Slide (Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Stomach Tissue Slide (Mucinous adenocarcinoma) (5 slides/pk) -- HTS-10810
Human Stomach Tissue Slide (Mucinous adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Stomach Tissue Slide (Normal) (5 slides/pk) -- HTS-10801
Human Stomach Tissue Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Stomach Tissue Slide (Signet Ring Cell Adenocarcinoma) (5 slides/pk) -- HTS-10811
Human Stomach Tissue Slide (Signet Ring Cell Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research...
Human Stomach Tissue Slide (Tumor) (5 slides/pk) -- HTS-10827
Human Stomach Tissue Slide (Tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Stomach Tumor lysate -- HTL-1340
Human Stomach Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Testis Tissue Slide (Abnormal) (5 slides/pk) -- HTS-11710
Human Testis Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Testis Tissue Slide (Normal) (5 slides/pk) -- HTS-11701
Human Testis Tissue Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Testis Tumor lysate -- HTL-1381
Human Testis Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Thymoma Tumor lysate -- HTL-1382
Human Thymoma Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Thyroid Tissue Slide (Abnormal) (5 slides/pk) -- HTS-11018
Human Thyroid Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Thyroid Tissue Slide (Benign) (5 slides/pk) -- HTS-11002
Human Thyroid Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Thyroid Tissue Slide (Follicular Carcinoma) (5 slides/pk) -- HTS-11006
Human Thyroid Tissue Slide (Follicular Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Thyroid Tissue Slide (Papillary Carcinoma) (5 slides/pk) -- HTS-11007
Human Thyroid Tissue Slide (Papillary Carcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Thyroid Tumor lysate -- HTL-1383
Human Thyroid Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue Blot I (brain, colon, kidney, liver, lung, pancreas, skin, spleen, stomach) -- HTPB-1542
Human Tumor Tissue Blot I (brain, colon, kidney, liver, lung, pancreas, skin, spleen, stomach) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use only, not for diagnostic or...
Human Tumor Tissue Blot II (colon, duodenum, esophagus, small intestine, liver, pancreas, rectum, stomach.) -- HTPB-1543
Human Tumor Tissue Blot II (colon, duodenum, esophagus, small intestine, liver, pancreas, rectum, stomach.) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use only, not for diagnostic or...
Human Tumor Tissue Blot III (bladder, breast, kidney, ovary, prostate, testis, cervix, uterus.) -- HTPB-1544
Human Tumor Tissue Blot III (bladder, breast, kidney, ovary, prostate, testis, cervix, uterus.) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use only, not for diagnostic or therapeutic...
Human Tumor Tissue Blot IV (kidney, liver, lymphoma, Non-Hodgkin?s, spleen, thymoma, thyroid, tonsil.) -- HTPB-1545
Human Tumor Tissue Blot IV (kidney, liver, lymphoma, Non-Hodgkin?s, spleen, thymoma, thyroid, tonsil.) General Information SpeciesReactivity Human Form Pre-blotted PVDF membrane For research use only, not for diagnostic or therapeutic...
Human Tumor Tissue: Small Intestine cDNA -- HT05-226
Human Tumor Tissue: Small Intestine cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue: Spleen cDNA -- HT05-246
Human Tumor Tissue: Spleen cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue: Stomach cDNA -- HT05-248
Human Tumor Tissue: Stomach cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue: Testis cDNA -- HT05-260
Human Tumor Tissue: Testis cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue: Thymus cDNA -- HT05-264
Human Tumor Tissue: Thymus cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue: Thyroid cDNA -- HT05-265
Human Tumor Tissue: Thyroid cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Tumor Tissue: Uterus cDNA -- HT05-274
Human Tumor Tissue: Uterus cDNA General Information SpeciesReactivity Human (Tumor) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Human Urogenital Tissue Slide (Fallopian Tube Abnormal) (5 slides/pk) -- HTS-11905
Human Urogenital Tissue Slide (Fallopian Tube Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Urogenital Tissue Slide (Fallopian Tube Benign) (5 slides/pk) -- HTS-11903
Human Urogenital Tissue Slide (Fallopian Tube Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Urogenital Tissue Slide (Fallopian Tube normal) (5 slides/pk) -- HTS-11901
Human Urogenital Tissue Slide (Fallopian Tube normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Urogenital Tissue Slide (Placenta Benign) (5 slides/pk) -- HTS-11913
Human Urogenital Tissue Slide (Placenta Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Urogenital Tissue Slide (Vas Deferens Benign) (5 slides/pk) -- HTS-11963
Human Urogenital Tissue Slide (Vas Deferens Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Urogenital Tissue Slide (Vas Deferens Normal) (5 slides/pk) -- HTS-11961
Human Urogenital Tissue Slide (Vas Deferens Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Uterus Tissue Slide (Abnormal) (5 slides/pk) -- HTS-11419
Human Uterus Tissue Slide (Abnormal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Uterus Tissue Slide (Adenocarcinoma) (5 slides/pk) -- HTS-11404
Human Uterus Tissue Slide (Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Uterus Tissue Slide (Adenomyoma) (5 slides/pk) -- HTS-11432
Human Uterus Tissue Slide (Adenomyoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Uterus Tissue Slide (Benign) (5 slides/pk) -- HTS-11402
Human Uterus Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Uterus Tissue Slide (Endometrioid Adenocarcinoma) (5 slides/pk) -- HTS-11405
Human Uterus Tissue Slide (Endometrioid Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only,...
Human Uterus Tissue Slide (Normal) (5 slides/pk) -- HTS-11401
Human Uterus Tissue Slide (Normal) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human Uterus Tissue Slide (Papillary serous Adenocarcinoma) (5 slides/pk) -- HTS-11407
Human Uterus Tissue Slide (Papillary serous Adenocarcinoma) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Uterus Tissue Slide (Spindle cell tumor) (5 slides/pk) -- HTS-11418
Human Uterus Tissue Slide (Spindle cell tumor) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use...
Human Uterus Tumor lysate -- HTL-1384
Human Uterus Tumor lysate General Information SpeciesReactivity Human (Tumor) Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Human Uvula Tissue Slide (Benign) (5 slides/pk) -- HTS-13003
Human Uvula Tissue Slide (Benign) (5 slides/pk) General Information SugApplications Ready for detecting appropriate proteins by IHC using antibodies SpeciesReactivity Human Form Slide for IHC For research use only, not...
Human+Bovine+Porcine Insulin-agarose affinity support -- INSL20-AS
Human+Bovine+Porcine Insulin-agarose affinity support General Information SpeciesReactivity Porcine Form Affinity column For research use only, not for diagnostic or therapeutic use.
Human/Mouse K-Cl Cotransporter 3 (KCC3-a) Control/blocking peptide #2 -- KCC32-P
Human/Mouse K-Cl Cotransporter 3 (KCC3-a) Control/blocking peptide #2 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is...
Hyaluronidase (1000 U/mg), Ovine Testis -- HYO-02
Hyaluronidase (1000 U/mg), Ovine Testis General Information SpeciesReactivity Ovine Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Hyaluronidase (300 U/mg), Ovine Testis -- HYO-01
Hyaluronidase (300 U/mg), Ovine Testis General Information SpeciesReactivity Ovine Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Hyaluronidase (5000 U/mg), Ovine Testis -- HYO-03
Hyaluronidase (5000 U/mg), Ovine Testis General Information SpeciesReactivity Ovine Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Kallikrein, Human Plasma -- KAL15-N-50
Kallikrein, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Keyhole Limpet Hemocyanin (KLH)-Agarose affinity gel for removing KLH antibodies -- KLH11-G
Keyhole Limpet Hemocyanin (KLH)-Agarose affinity gel for removing KLH antibodies General Information Antibodies to small peptide/haptens are generally raised by coupling to a large carrier proteins such as KLH. Antibodies...
Keyhole Limpet Hemocyanin (Megathura Crenulata) Carrier protein -- KLH51-R100
Keyhole Limpet Hemocyanin (Megathura Crenulata) Carrier protein General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins...
Kininogen, HMW, Human Plasma -- KINH15-N-50
Kininogen, HMW, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Kininogen, LMW, Human Plasma -- KINL15-N-50
Kininogen, LMW, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Lactate dehydrogenase (300 U/mg), Porcine Heart, freeze dried powder -- LDH-01
Lactate dehydrogenase (300 U/mg), Porcine Heart, freeze dried powder General Information SpeciesReactivity Porcine Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Lactate dehydrogenase (550 U/mg), Rabbit Muscle, freeze dried powder -- LDH-02
Lactate dehydrogenase (550 U/mg), Rabbit Muscle, freeze dried powder General Information SpeciesReactivity Rabbit Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Lactoferrin, Human Neutrophil -- LTF15-N-50
Lactoferrin, Human Neutrophil General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
LEESQVNDDIFNSLVKSVQQEQQHNV, P. falciparum Liver-Stage Antigen 3-NRII, LSA3-NRII (81-106) peptide -- LSPF31-P
LEESQVNDDIFNSLVKSVQQ EQQHNV, P. falciparum Liver-Stage Antigen 3-NRII, LSA3-NRII (81-106) peptide General Information SpeciesReactivity P. falciparum Form Pure peptide For research use only, not for diagnostic or therapeutic use.
Lethal factor protease Inhibitor-1, Cell permeable, 14aa MEK2 analog, competitive inhibitor of LF -- LFPI-4
Lethal factor protease Inhibitor-1, Cell permeable, 14aa MEK2 analog, competitive inhibitor of LF General Information LFPI-4 is a cell-permeable N-acetylated, C-hydroxamate derivative of a 14-mer peptide designed from the MEK-2...
Lethal factor Protease Substrate 1, Internally quenched Coumarin peptide substrate for monitoring LF protease activity (19aa) -- LFPS-1
Lethal factor Protease Substrate 1, Internally quenched Coumarin peptide substrate for monitoring LF protease activity (19aa) General Information LFPS-1 is internally-quenched fluorogenic 19-mer peptide substrate derived from the MAP kinase...
Lethal factor Protease Substrate 2, pNA derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) -- LFPS-2
Lethal factor Protease Substrate 2, pNA derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) General Information LFPS-2 is an N-acetylated, C-p-nitroanilide (pNA) derivative of a 14-mer peptide...
Lethal factor Protease Substrate 3, AMC derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) -- LFPS-3
Lethal factor Protease Substrate 3, AMC derivative MEk2 peptide substrate for high-throughput screening of LF inhibitors (14aa) General Information LFPS-3 An N-acetylated, C-7-amido-4-methylco umarin (AMC) derivative of a 14-mer peptide...
Lipopolysaccharides (LPS) from E. coli (strain 011:B4), cell culture grade -- LPS11-1
Lipopolysaccharides (LPS) from E. coli (strain 011:B4), cell culture grade General Information SpeciesReactivity E. coli Form Chemical For research use only, not for diagnostic or therapeutic use.
Lipopolysaccharides (LPS) from E. coli (strain K-235) purified -- LPS12-1
Lipopolysaccharides (LPS) from E. coli (strain K-235) purified General Information SpeciesReactivity E. coli Form Chemical For research use only, not for diagnostic or therapeutic use.
Lipopolysaccharides (LPS) from P. aeruginosa, purified -- LPS13-1
Lipopolysaccharides (LPS) from P. aeruginosa, purified General Information SpeciesReactivity P. aeruginosa Form Chemical For research use only, not for diagnostic or therapeutic use.
Lipopolysaccharides (LPS) from Salmonella enterica, purified -- LPS14-1
Lipopolysaccharides (LPS) from Salmonella enterica, purified General Information SpeciesReactivity Salmonella enterica Form Chemical For research use only, not for diagnostic or therapeutic use.
Lipoprotein a, [Lp(a)], Human Plasma -- LIPA15-N-50
Lipoprotein a, [Lp(a)], Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Lipoproteins, High Density, Human Plasma -- LIPH16-N
Lipoproteins, High Density, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Lipoproteins, Intermediate Density, Human Plasma -- LIPI17-N
Lipoproteins, Intermediate Density, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Lipoproteins, Low Density, Human Plasma -- LIPL18-N
Lipoproteins, Low Density, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Lipoproteins, Very Low Density, Human Plasma -- LIPV19-N
Lipoproteins, Very Low Density, Human Plasma General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Lipoxidase (100000 U/mg) -- LPX-01
Lipoxidase (100000 U/mg) General Information SpeciesReactivity Soybean Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Lipoxidase (200000 U/mg) -- LPX-02
Lipoxidase (200000 U/mg) General Information SpeciesReactivity Soybean Form Freeze dried powder For research use only, not for diagnostic or therapeutic use.
Lysozyme, Human Neutrophil -- LYZM15-N-100
Lysozyme, Human Neutrophil General Information SugApplications ELISA, Western, antibody blocking SpeciesReactivity Human For research use only, not for diagnostic or therapeutic use.
Maltose binding protein (MBP) (fusion tag) control for ELISA -- MBP15-R-1000
Maltose binding protein (MBP) (fusion tag) control for ELISA General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of...
Maltose binding protein (MBP) (fusion tag) control for western -- MBP11-C
Maltose binding protein (MBP) (fusion tag) control for western General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of...
Monkey (Cynomolgus) cDNA Normal Tissue: Adipose -- MC34-003
Monkey (Cynomolgus) cDNA Normal Tissue: Adipose General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Adrenal -- MC34-004
Monkey (Cynomolgus) cDNA Normal Tissue: Adrenal General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Appendix -- MC34-006
Monkey (Cynomolgus) cDNA Normal Tissue: Appendix General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Bladder -- MC34-010
Monkey (Cynomolgus) cDNA Normal Tissue: Bladder General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Brain -- MC34-035
Monkey (Cynomolgus) cDNA Normal Tissue: Brain General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Breast -- MC34-086
Monkey (Cynomolgus) cDNA Normal Tissue: Breast General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Colon -- MC34-090
Monkey (Cynomolgus) cDNA Normal Tissue: Colon General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Eye -- MC34-109
Monkey (Cynomolgus) cDNA Normal Tissue: Eye General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Heart -- MC34-122
Monkey (Cynomolgus) cDNA Normal Tissue: Heart General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Kidney -- MC34-142
Monkey (Cynomolgus) cDNA Normal Tissue: Kidney General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Liver -- MC34-149
Monkey (Cynomolgus) cDNA Normal Tissue: Liver General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Lung -- MC34-152
Monkey (Cynomolgus) cDNA Normal Tissue: Lung General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Ovary -- MC34-183
Monkey (Cynomolgus) cDNA Normal Tissue: Ovary General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Pancreas -- MC34-188
Monkey (Cynomolgus) cDNA Normal Tissue: Pancreas General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Prostate -- MC34-201
Monkey (Cynomolgus) cDNA Normal Tissue: Prostate General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Rectum -- MC34-206
Monkey (Cynomolgus) cDNA Normal Tissue: Rectum General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Skeletal Muscle -- MC34-171
Monkey (Cynomolgus) cDNA Normal Tissue: Skeletal Muscle General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Skin -- MC34-218
Monkey (Cynomolgus) cDNA Normal Tissue: Skin General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Small Intestine -- MC34-226
Monkey (Cynomolgus) cDNA Normal Tissue: Small Intestine General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Spinal Cord -- MC34-234
Monkey (Cynomolgus) cDNA Normal Tissue: Spinal Cord General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Spleen -- MC34-246
Monkey (Cynomolgus) cDNA Normal Tissue: Spleen General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monkey (Cynomolgus) cDNA Normal Tissue: Stomach -- MC34-248
Monkey (Cynomolgus) cDNA Normal Tissue: Stomach General Information SpeciesReactivity Monkey (Cynomolgus) Form PCR Ready For research use only, not for diagnostic or therapeutic use.
Monoclonal Anti-Anthrax Lethal factor (LF) protein IgG biotinylated -- LF12-MB
Monoclonal Anti-Anthrax Lethal factor (LF) protein IgG biotinylated General Information Anthrax lethal toxin produced by the bacterium Bacillus anthracis is the major cause of death in animals infected with anthrax.
Monoclonal Anti-Anthrax Lethal factor antigen IgG #1, aff pure -- LF11-M
Monoclonal Anti-Anthrax Lethal factor antigen IgG #1, aff pure General Information Anthrax lethal toxin produced by the bacterium Bacillus anthracis is the major cause of death in animals infected with...
Monoclonal Anti-Anthrax Lethal factor antigen IgG #2, aff pure -- LF12-M
Monoclonal Anti-Anthrax Lethal factor antigen IgG #2, aff pure General Information Anthrax lethal toxin produced by the bacterium Bacillus anthracis is the major cause of death in animals infected with...
Monoclonal Anti-Human Insulin C-peptide IgG, aff pure -- INSC23-M
Monoclonal Anti-Human Insulin C-peptide IgG, aff pure General Information SugSecAntibodies http://4adi.com/comm erce/ccc2486-seconda ry-antibodies-mouse. htm SpeciesReactivity Human SugNegativeControl Non-immune Rabbit IgG Cat# 20008-1 Form Antibody pure IgG For research use only,...
Monoclonal Anti-Human Insulin C-terminal pentapeptide IgG, aff pure -- INSL15-M
Monoclonal Anti-Human Insulin C-terminal pentapeptide IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested...
Monoclonal Anti-Human Insulin IgG, aff pure -- INSL13-M
Monoclonal Anti-Human Insulin IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG #1 -- IGFBP12-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG #1 General Information Unlike insulin, both IGF-I and IGF-II circulate in plasma tightly bound to specific binding proteins. Two...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG #2 -- IGFBP14-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG #2 General Information Unlike insulin, both IGF-I and IGF-II circulate in plasma tightly bound to specific binding proteins. Two...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG -- IGFBP22-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2, BP2, IBP2 Gene name...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein IgG -- IGFBP32-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein IgG General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein IgG -- IGFBP42-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein IgG General Information Insulin-like growth factor binding protein-4 (IGFBP-4, 22-237 aa mature protein, protein accession # P22692) is expressed in...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein IgG -- IGFBP52-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein IgG General Information Human IGFBP-5 is a 252-aa mature protein that is expressed by fibroblasts, myoblasts and osteoblasts, making it...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure -- IGFBP62-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure General Information Human IGFBP-6 is a 240-aa (mature protein 27-240aa). IGFBP6 plays a role in lipoprotein assembly...
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG -- IGFBP72-M
Monoclonal Anti-Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG General Information IGF-BP7 is expressed in a wide range of normal human tissues and it generally shows reduced expression in...
Monoclonal Anti-Human Leptin Protein antibody # 3, ascites -- LEP13-M
Monoclonal Anti-Human Leptin Protein antibody # 3, ascites General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least...
Monoclonal Anti-Human Leptin Protein IgG #3, purified -- LEP32-M
Monoclonal Anti-Human Leptin Protein IgG #3, purified General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and...
Monoclonal Anti-Human Leptin Protein IgG-Biotinylated -- LEP32-BTN
Monoclonal Anti-Human Leptin Protein IgG-Biotinylated General Information SpeciesReactivity Human Form Antibody, Ascites unpurified Antigen Purified, human recombinant leptin (#LEP12-R) For research use only, not for diagnostic or therapeutic use.
Monoclonal Anti-Human Pro-Insulin IgG, aff pure -- INSL14-M
Monoclonal Anti-Human Pro-Insulin IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will...
monoclonal Anti-KLH (keyhole leimpet hemocyanin) Ascites -- KLH12-M
monoclonal Anti-KLH (keyhole leimpet hemocyanin) Ascites General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Monoclonal Anti-Maltose binding protein (MBP) (fusion tag) ascites -- MBP11-M
Monoclonal Anti-Maltose binding protein (MBP) (fusion tag) ascites General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant...
Monoclonal Anti-Maltose binding protein (MBP)-AP conjugate -- MBP11-AP
Monoclonal Anti-Maltose binding protein (MBP)-AP conjugate General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Monoclonal Anti-Maltose binding protein (MBP)-HRP conjugate -- MBP11-HRP
Monoclonal Anti-Maltose binding protein (MBP)-HRP conjugate General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG -- IGFBP13-M
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein IgG General Information Unlike insulin, both IGF-I and IGF-II circulate in plasma tightly bound to specific binding proteins. Two major...
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG -- IGFBP23-M
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein IgG General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2, BP2, IBP2 Gene name...
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein IgG -- IGFBP33-M
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein IgG General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or...
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein IgG -- IGFBP53-M
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein IgG General Information Human IGFBP-5 is a 252-aa mature protein that is expressed by fibroblasts, myoblasts and osteoblasts, making it...
Monoclonal Anti-mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure -- IGFBP63-M
Monoclonal Anti-mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein IgG, aff pure General Information Human IGFBP-6 is a 240-aa (mature protein 27-240aa). IGFBP6 plays a role in lipoprotein assembly...
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG -- IGFBP73-M
Monoclonal Anti-Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) IgG General Information IGF-BP7 is expressed in a wide range of normal human tissues and it generally shows reduced expression in...
Monoclonal Anti-Mouse Klotho IgG, aff pure -- KL12-M
Monoclonal Anti-Mouse Klotho IgG, aff pure General Information Animal models of human aging, which display the characteristic diseases associated with aging, provide insight into the cause of such diseases. Recently...
Monoclonal Anti-Rat C-peptide IgG, aff pure -- INSL16-M
Monoclonal Anti-Rat C-peptide IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will...
Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure -- INSL11-M
Monoclonal Anti-Rat/Mouse Insulin/proinsulin IgG, aff pure General Information SugApplications Most Antibodies are tested by ELISA and Western. Additional applications, such as IHC or IP may have been tested and will...
Mouse Adipose Whole tissue lysate -- MAL-1418
Mouse Adipose Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Adrenal Whole tissue lysate -- MAL-1417
Mouse Adrenal Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Anti-Influenza A virus IgG, aff pure -- INFA11-M
Mouse Anti-Influenza A virus IgG, aff pure General Information SugApplications ELISA, Western IHC/IF SugSecAntibodies http://4adi.com/comm erce/ccc2486-seconda ry-antibodies-mouse. htm SpeciesReactivity Influenza A virus SugNegativeControl Non-immune Rabbit IgG Cat# 20008-1 Form Antibody...
Mouse Anti-Influenza B IgG, aff pure -- INFB15-M
Mouse Anti-Influenza B IgG, aff pure General Information SugApplications ELISA, Western IHC/IF SugSecAntibodies http://4adi.com/comm erce/ccc2486-seconda ry-antibodies-mouse. htm SpeciesReactivity Influenza B virus SugNegativeControl Non-immune Rabbit IgG Cat# 20008-1 Form Antibody Pure...
Mouse beta-Defensin 1 control/blocking peptide #1 -- MBD11-P
Mouse beta-Defensin 1 control/blocking peptide #1 General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into two...
Mouse beta-Defensin 1 full length (37 aa, oxidized) peptide; note replaces MBD12-P -- MBD14-P
Mouse beta-Defensin 1 full length (37 aa, oxidized) peptide; note replaces MBD12-P General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome...
Mouse beta-Defensin 3 full length synthetic peptide (40 aa, linear, no disulfides); note: replaces MBD33-P -- MBD35-P
Mouse beta-Defensin 3 full length synthetic peptide (40 aa, linear, no disulfides); note: replaces MBD33-P General Information The genes encoding human a and ß -defensins are clustered in a contiguous...
Mouse beta-Defensin 3 full length synthetic peptide (40 aa, oxidized, 3 disulfides); note: replaces MBD32-P: -- MBD34-P
Mouse beta-Defensin 3 full length synthetic peptide (40 aa, oxidized, 3 disulfides); note: replaces MBD32-P: General Information The genes encoding human a and ß -defensins are clustered in a contiguous...
Mouse beta-Defensin 4 control/blocking peptide #1 -- MBD41-P
Mouse beta-Defensin 4 control/blocking peptide #1 General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into two...
Mouse Bladder Whole tissue lysate -- MAL-1410
Mouse Bladder Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Brain Whole tissue lysate -- MAL-1403
Mouse Brain Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Cerebellum Whole tissue lysate -- MAL-1412
Mouse Cerebellum Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Cerebrum Whole tissue lysate -- MAL-1413
Mouse Cerebrum Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Colon Whole tissue lysate -- MAL-1411
Mouse Colon Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Eye Whole tissue lysate -- MAL-1420
Mouse Eye Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Heart Whole tissue lysate -- MAL-1401
Mouse Heart Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Hexokinase 1 (HXK-I) Control/blocking peptide -- HXK13-P
Mouse Hexokinase 1 (HXK-I) Control/blocking peptide General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by its...
Mouse Hexokinase 1-4 (HXK1-IV) Control/blocking peptide -- HXKX15-P
Mouse Hexokinase 1-4 (HXK1-IV) Control/blocking peptide General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by its...
Mouse Hexokinase 2 (HXK-II) Control/blocking peptide -- HXK23-P
Mouse Hexokinase 2 (HXK-II) Control/blocking peptide General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by its...
Mouse Hexokinase 3 (HXK-III) Control/blocking peptide -- HXK33-P
Mouse Hexokinase 3 (HXK-III) Control/blocking peptide General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by its...
Mouse Hexokinase 4/GCK (HXK-IV) Control/blocking peptide -- HXK43-P
Mouse Hexokinase 4/GCK (HXK-IV) Control/blocking peptide General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric enzyme inhibited by its...
Mouse i-NOS/NOS-II Control/blocking peptide # 2 -- iNOS22-P
Mouse i-NOS/NOS-II Control/blocking peptide # 2 General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized by...
Mouse iNOS (macrophage) cDNA probe -- iNOS61-D-2
Mouse iNOS (macrophage) cDNA probe General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized by L-arginine,...
Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] -- INSC35-P
Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAG DLQTLALEVAQQ ] General Information SpeciesReactivity Mouse Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Mouse K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #1 -- KCC41-P
Mouse K-Cl Cotransporter 4 (KCC4) Control/blocking peptide #1 General Information Most recently, KCC4 (mouse and human 1083 aa) have been cloned that are 65-71% identical to KCC1/KCC2. It is highly...
Mouse Kidney Whole tissue lysate -- MAL-1405
Mouse Kidney Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Klotho Control/blocking peptide -- KL11-P
Mouse Klotho Control/blocking peptide General Information Animal models of human aging, which display the characteristic diseases associated with aging, provide insight into the cause of such diseases. Recently a transgenic...
Mouse Leptin protein Western blot +ve control # 1 -- LEP11-C
Mouse Leptin protein Western blot +ve control # 1 General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At...
Mouse Lipin-1 Control/blocking peptide control/blocking peptide #1 -- LPN11-P
Mouse Lipin-1 Control/blocking peptide control/blocking peptide #1 General Information Lipin-1: The human and mouse LPIN-1 genes have been mapped at chromosomes 2p21 and 12, respectively. A region (POMC) on this...
Mouse Lipin-2 Control/blocking peptide control/blocking peptide #1 -- LPN21-P
Mouse Lipin-2 Control/blocking peptide control/blocking peptide #1 General Information Lipin-2: The human and mouse LPIN-2 genes have been mapped at chromosomes 18p and 17, respectively. The Lipin-2 seqs from mouse...
Mouse Lipin-3 Control/blocking peptide control/blocking peptide #1 -- LPN31-P
Mouse Lipin-3 Control/blocking peptide control/blocking peptide #1 General Information Lipin-3: The human (LPIN3) and mouse Lipin3 genes have been mapped at chromosomes 20q and 2, respectively. The overall aa seq...
Mouse Liver Whole tissue lysate -- MAL-1404
Mouse Liver Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Lung Whole tissue lysate -- MAL-1402
Mouse Lung Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Monoclonal Anti-mouser/rat NOS-II/i-NOS peptide IgG #3 -- INOS23-M
Mouse Monoclonal Anti-mouser/rat NOS-II/i-NOS peptide IgG #3 General Information Antigen P Form Antibody Pure IgG For research use only, not for diagnostic or therapeutic use.
Mouse NOS-II/i-NOS Control/blocking peptide # 1 -- iNOS-P
Mouse NOS-II/i-NOS Control/blocking peptide # 1 General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized by...
Mouse NOS-II/i-NOS Protein for ELISA Standard -- iNOS-R
Mouse NOS-II/i-NOS Protein for ELISA Standard General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO is synthesized by...
Mouse NOS-II/i-NOS Protein Western Blot +ve Control # 1 -- iNOS-C
Mouse NOS-II/i-NOS Protein Western Blot +ve Control # 1 General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral nervous system. NO...
Mouse Pancreas Whole tissue lysate -- MAL-1414
Mouse Pancreas Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Recombinant Purified Leptin Protein -- LEP11-R-5000
Mouse Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Mouse Recombinant Purified Leptin Triple mutant Antagonist Protein -- LEP23-TM-20
Mouse Recombinant Purified Leptin Triple mutant Antagonist Protein General Information SpeciesReactivity Mouse Form Antigen Protein Antigen Leptin is ~16 kDa, adipocyte derived, secreted protein (1). Recombinant mouse leptin, containing 146...
Mouse Skeletal Muscle Whole tissue lysate -- MAL-1407
Mouse Skeletal Muscle Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Skin Whole tissue lysate -- MAL-1419
Mouse Skin Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Small Intestine Whole tissue lysate -- MAL-1408
Mouse Small Intestine Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Spleen Whole tissue lysate -- MAL-1406
Mouse Spleen Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Stomach Whole tissue lysate -- MAL-1415
Mouse Stomach Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Testis Whole tissue lysate -- MAL-1416
Mouse Testis Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse Thymus Whole tissue lysate -- MAL-1409
Mouse Thymus Whole tissue lysate General Information SugApplications Western blot SpeciesReactivity Mouse Form Protein Lysate for WB For research use only, not for diagnostic or therapeutic use.
Mouse/human beta-Defensin 3 control/blocking peptide #1 -- MBD31-P
Mouse/human beta-Defensin 3 control/blocking peptide #1 General Information The genes encoding human a and ß -defensins are clustered in a contiguous segment of chromosome 8p23. Defensins are classified into two...
Mouse/Human Mahogany Control/blocking peptide #1 -- MAHG11-P
Mouse/Human Mahogany Control/blocking peptide #1 General Information The Mahogany (mg) mutations suppress the effect of lethal yellow including obesity. The Mahogany locus does not suppress the obese phenotype of the...
Mouse/rat Insulin B chain peptide (25-44 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] -- INSB25-P
Mouse/rat Insulin B chain peptide (25-44 aa) [FVKQHLCGSHLVEALYLVC GERGFFYTPMS] General Information SpeciesReactivity Mouse Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Mouse/rat/hamster/ Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN] -- INSA15-P
Mouse/rat/hamster/ Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENY CN] General Information SpeciesReactivity Mouse Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Ovine Recombinant Purified Leptin Protein -- LEP14-R-50
Ovine Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Ovine Recombinant Purified Leptin Quadruple mutant mutant Antagonist Protein -- LEP26-QM-20
Ovine Recombinant Purified Leptin Quadruple mutant mutant Antagonist Protein General Information SpeciesReactivity Ovine Form Antigen Protein Antigen Leptin is ~16 kDa, adipocyte derived, secreted protein (1). Recombinant Ovine leptin, containing...
Ovine Recombinant Purified Leptin Triple mutant Antagonist Protein -- LEP25-TM-20
Ovine Recombinant Purified Leptin Triple mutant Antagonist Protein General Information SpeciesReactivity Ovine Form Antigen Protein Antigen Leptin is ~16 kDa, adipocyte derived, secreted protein (1). Recombinant Ovine leptin, containing 146...
Photobacterium fischerii Luciferase protein (partially pure) WB +ve control -- LUCF12-C
Photobacterium fischerii Luciferase protein (partially pure) WB +ve control General Information SpeciesReactivity Photobacterium fischerii Form Protein Control For research use only, not for diagnostic or therapeutic use.
Photobacterium fischerii Luciferase protein (partially pure), active -- LUCF16-N-10
Photobacterium fischerii Luciferase protein (partially pure), active General Information SpeciesReactivity Photobacterium fischerii Form Protein Control For research use only, not for diagnostic or therapeutic use.
Porcine Insulin (~30 USP U/mg) -- INSL19-N-10
Porcine Insulin (~30 USP U/mg) General Information SpeciesReactivity Porcine Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Porcine Insulin-agarose affinity support -- INSL19-AS
Porcine Insulin-agarose affinity support General Information SpeciesReactivity Porcine Form Affinity column For research use only, not for diagnostic or therapeutic use.
Porcine Recombinant Purified Leptin Protein -- LEP16-R-50
Porcine Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control -- IGFBP51-C
Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control General Information Human IGFBP-5 is a 252-aa mature protein that is expressed by fibroblasts, myoblasts and...
Purified Recombinant Anthrax lethal factor (LF) protein control for WB -- LF13-C
Purified Recombinant Anthrax lethal factor (LF) protein control for WB General Information After inhalation by mammals, Bacillus anthracis spores germinate in alveolar macrophages then migrate to lymph nodes where they...
Purified Recombinant Anthrax Lethal Factor protein -- LF15-R
Purified Recombinant Anthrax Lethal Factor protein General Information Anthrax lethal toxin produced by the bacterium Bacillus anthracis is the major cause of death in animals infected with anthrax. One component...
Rabbit Recombinant Purified Leptin Protein -- LEP20-R-50
Rabbit Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1 -- IRAP11-P
Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1 General Information Tankyrases, renamed as TNKS-1/TANK1, a modular protein with homology to ankyrin and poly(adenosine diphosphate-ribose) polymerase (PARP) has been cloned and...
Rat Iron regulatory protein 1 (IRP-1) control/blocking peptide -- IRP11-P
Rat Iron regulatory protein 1 (IRP-1) control/blocking peptide General Information Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation of...
Rat K-Cl Cotransporter 1 (KCC1) Control/blocking peptide #1 -- KCC11-P
Rat K-Cl Cotransporter 1 (KCC1) Control/blocking peptide #1 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is...
Rat K-Cl Cotransporter 2 (KCC2) Control/blocking peptide #1 -- KCC21-P
Rat K-Cl Cotransporter 2 (KCC2) Control/blocking peptide #1 General Information The K-Cl cotransporters mediate the coupled movement of K+ and Cl- ions across the cell membranes. This transport process is...
Rat Recombinant Purified Leptin Protein -- LEP13-R-1000
Rat Recombinant Purified Leptin Protein General Information Obesity, a common nutritional disorder, is associated with diabetes, hypertension, hyperlipidemia, cancer and many other health related problems. At least five genes, Obese...
Rat Recombinant Purified Leptin Triple mutant Antagonist Protein -- LEP24-TM-100
Rat Recombinant Purified Leptin Triple mutant Antagonist Protein General Information SpeciesReactivity Rat Form Antigen Protein Antigen Leptin is ~16 kDa, adipocyte derived, secreted protein (1). Recombinant rat leptin, containing 146...
Rat/human Iron regulatory protein 2 (IRP-2) control/blocking peptide -- IRP21-P
Rat/human Iron regulatory protein 2 (IRP-2) control/blocking peptide General Information Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation of...
ReadyBlot Brain Protein Explorer (Adult Mice), 1 blot -- MBWB-11
ReadyBlot Brain Protein Explorer (Adult Mice), 1 blot General Information SpeciesReactivity Mouse Form Immunoblot For research use only, not for diagnostic or therapeutic use.
ReadyBlot Brain Protein Explorer (Newborn Mice), 1 blot -- MBWB-12
ReadyBlot Brain Protein Explorer (Newborn Mice), 1 blot General Information SpeciesReactivity Mouse Form Immunoblot For research use only, not for diagnostic or therapeutic use.
ReadyBlot Brain Protein Explorer (~18-24 months Old Mice), 1 blot -- MBWB-13
ReadyBlot Brain Protein Explorer (~18-24 months Old Mice), 1 blot General Information SpeciesReactivity Mouse Form Immunoblot For research use only, not for diagnostic or therapeutic use.
Recombinant (E. coli) purified Human Hexokinase 1 (HXK-1/HK-1), full length -- HXKX15-R-10
Recombinant (E. coli) purified Human Hexokinase 1 (HXK-1/HK-1), full length General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric...
Recombinant (E. coli) purified Human Hexokinase 2 (HXK-2/HK-2), full length -- HXKX25-R-10
Recombinant (E. coli) purified Human Hexokinase 2 (HXK-2/HK-2), full length General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric...
Recombinant (E. coli) purified Human Hexokinase 3 (HXK-3/HK-3), full length -- HXKX35-R-10
Recombinant (E. coli) purified Human Hexokinase 3 (HXK-3/HK-3), full length General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric...
Recombinant (E. coli) purified Human Hexokinase 4/Glucokinase (HXK-4/HK-4/GCK), full length -- HXKX45-R-10
Recombinant (E. coli) purified Human Hexokinase 4/Glucokinase (HXK-4/HK-4/GCK), full length General Information Hexokinase catalyzes the first step of several metabolic pathways by converting D-hexose to D-hexose-6-P. Hexokinase is an allosteric...
Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein -- IGFBP35-R-10
Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either...
Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB -- IGFBP71-C
Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB General Information IGF-BP7 is expressed in a wide range of normal human tissues and...
Recombinant (E. coli) Purified human insulin-like growth factor binding protein 6 (IGFBP-6) protein WB +ve control -- IGFBP65-R-10
Recombinant (E. coli) Purified human insulin-like growth factor binding protein 6 (IGFBP-6) protein WB +ve control General Information Human IGFBP-6 is a 240-aa (mature protein 27-240aa). IGFBP6 plays a role...
Recombinant (E. coli) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control -- IGFBP75-R-10
Recombinant (E. coli) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control General Information IGF-BP7 is expressed in a wide range of normal human tissues and...
Recombinant (E. coli) Purified human recomb. human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control -- IGFBP55-R-10
Recombinant (E. coli) Purified human recomb. human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control General Information Human IGFBP-5 is a 252-aa mature protein that is expressed...
Recombinant (E. coli, His-tag, >95%) human Livin-beta (Beta/ML-IAP) protein WB + control -- LIVN11-C
Recombinant (E. coli, His-tag, >95%) human Livin-beta (Beta/ML-IAP) protein WB + control General Information Human Livin (1-280 aa. ~32 Kda) was expressed as his-tag protein in E. colli and purified...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB -- IGFBP11-C
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB General Information SpeciesReactivity Human Form Protein control Antigen Human IGFBP-1 (218-aa ~28.8 kda, protein accession...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein -- IGFBP15-R-10
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein General Information IGFBP1 is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB -- IGFBP22-C
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2,...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein -- IGFBP26-R-10
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2, BP2, IBP2 Gene...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB -- IGFBP41-C
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB General Information Insulin-like growth factor binding protein-4 (IGFBP-4, 22-237 aa mature protein, protein accession #...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein -- IGFBP45-R-10
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein General Information Insulin-like growth factor binding protein-4 (IGFBP-4, 22-237 aa mature protein, protein accession # P22692) is expressed...
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB -- IGFBP61-C
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB General Information Human IGFBP-6 is a 240-aa (mature protein 27-240aa). IGFBP6 plays a role in...
Recombinant (NSO) Purified Mouse human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control -- IGFBP66-R-10
Recombinant (NSO) Purified Mouse human insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control General Information Human IGFBP-6 is a 240-aa (mature protein 27-240aa). IGFBP6 plays a role...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB -- IGFBP13-C
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB General Information Unlike insulin, both IGF-I and IGF-II circulate in plasma tightly bound to specific...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein -- IGFBP16-R-10
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein General Information IGFBP1 is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB -- IGFBP23-C
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2,...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein -- IGFBP25-R-10
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein General Information Protein name Insulin-like growth factor-binding protein 2 Synonyms IGFBP-2, IBP-2, IGF-binding protein 2, BP2, IBP2 Gene...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein -- IGFBP36-R-10
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein -- IGFBP56-R-10
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein General Information Human IGFBP-5 is a 252-aa mature protein that is expressed by fibroblasts, myoblasts and osteoblasts, making...
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB -- IGFBP63-C
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB General Information Human IGFBP-6 is a 240-aa (mature protein 27-240aa). IGFBP6 plays a role in...
Recombinant (Sf21) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control -- IGFBP76-R-10
Recombinant (Sf21) Purified human insulin-like growth factor binding protein 7 (IGFBP-7) protein WB +ve control General Information IGF-BP7 is expressed in a wide range of normal human tissues and it...
Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB -- IGFBP73-C
Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB General Information IGF-BP7 is expressed in a wide range of normal human tissues and it...
Recombinant (Yeast) Human Glargine (Insulin analog) (USP grade) for cell culture and ELISA -- INSL17-N-5
Recombinant (Yeast) Human Glargine (Insulin analog) (USP grade) for cell culture and ELISA General Information SpeciesReactivity Bovine Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Recombinant (Yeast) Human Insulin (USP grade) for cell culture and ELISA -- INSL16-N-5
Recombinant (Yeast) Human Insulin (USP grade) for cell culture and ELISA General Information SpeciesReactivity Bovine Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Recombinant (Yeast) Human Lispro (Insulin analog) (USP grade) for cell culture and ELISA -- INSL18-N-5
Recombinant (Yeast) Human Lispro (Insulin analog) (USP grade) for cell culture and ELISA General Information SpeciesReactivity Bovine Form Antigen protein For research use only, not for diagnostic or therapeutic use.
Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control -- IGFBP31-C
Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either...
Recombinant Human Insulin-agarose affinity support -- INSL16-AS
Recombinant Human Insulin-agarose affinity support General Information SpeciesReactivity Human Form Affinity column For research use only, not for diagnostic or therapeutic use.
Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control -- IGFBP33-C
Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control General Information FUNCTION: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either...
Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein -- IGFBP53-C
Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein General Information Human IGFBP-5 is a 252-aa mature protein that is expressed by fibroblasts, myoblasts and osteoblasts, making it the...
Recombinant purified allergen 1 of apple, Malus domestica Isoform Mal d 1.0108 -- MALD15-R-100
Recombinant purified allergen 1 of apple, Malus domestica Isoform Mal d 1.0108 General Information SpeciesReactivity Malus domestica, Form Antigen protein Antigen Mal d 1.8 is a recombinant protein with IgE-binding...
Recombinant purified Firefly Luciferase protein WB +ve control -- LUCF11-C
Recombinant purified Firefly Luciferase protein WB +ve control General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant...
Recombinant purified Firefly Luciferase protein, active -- LUCF15-R
Recombinant purified Firefly Luciferase protein, active General Information Expression of genes in E. coli or yeast or baculovirus offers a convenient system to produce large amounts of recombinant proteins that...
Recombinant purified human IKB-alpha (E., coli; GST-tag; IKB-alpha), active -- IKBA16-R-10
Recombinant purified human IKB-alpha (E., coli; GST-tag; IKB-alpha), active General Information SpeciesReactivity Human Form Recombinant Protein Antigen Recombinant E. coli GST-tag IKB-alpha, full length, purified (>80%, 61 kda with tag)...
Recombinant purified human IKB-alpha (E., coli; His-tag; 1-317 aa), active -- IKBA15-R-5
Recombinant purified human IKB-alpha (E., coli; His-tag; 1-317 aa), active General Information SpeciesReactivity Human Form Recombinant Protein Antigen Recombinant E. coli His-tag IKB-alpha (1-317aa) purified (>95%, 36 kda) For research...
Recombinant purified human IKB-beta (E., coli; GST-tag; IKB-beta), active -- IKBB25-R-10
Recombinant purified human IKB-beta (E., coli; GST-tag; IKB-beta), active General Information SpeciesReactivity Human Form Recombinant Protein Antigen Recombinant E. coli GST-tag IKB-beta, full length, purified (>80%, 64 kda with tag)...
Recombinant purified human IKKB-beta (Sf9; GST-His-IKK-B), active -- IKKB35-R-5
Recombinant purified human IKKB-beta (Sf9; GST-His-IKK-B), active General Information SpeciesReactivity Human Form Recombinant Protein Antigen Recombinant (sf9) GST-His-tag IKB-beta (1-756) purified (>95%, ~120 kda). For research use only, not for...
Recombinant purified Human Klotho protein (NS0 cells, His-tag; Alpha form; EC domain), active -- KL16-R
Recombinant purified Human Klotho protein (NS0 cells, His-tag; Alpha form; EC domain), active General Information SpeciesReactivity Human Form Protein Control For research use only, not for diagnostic or therapeutic use.
Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) control for Western -- INOS25-C
Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) control for Western General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in...
Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) -- INOS25-R-10
Recombinant purified Mouse Inducible Nitric Oxide Syntahse (iNOS-II/i-NOS) protein (full length, His-tag) General Information Nitric oxide (NO), a diffusible free radical gas, acts as a neurotransmitter in brain and peripheral...
Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain) western blot control -- KL12-C
Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain) western blot control General Information SpeciesReactivity Mouse Form Protein Control For research use only, not for diagnostic or...
Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain), active -- KL15-R
Recombinant purified Mouse Klotho protein (CHO cells, His-tag; Alpha form; EC domain), active General Information SpeciesReactivity Mouse Form Protein Control For research use only, not for diagnostic or therapeutic use.
Recombinant purified, human Interleukin-1 alpha (IL-1 alpha), active -- IL1A15-R-10
Recombinant purified, human Interleukin-1 alpha (IL-1 alpha), active General Information Human AKT3 fusion protein ~66kD (his-tag at the N-terminus) was expressed in sf21 cell and purified >50%. Human AKT31-C protein...

<< Prev Next >>